Commonly used English terms for computers.
Commonly used English terms and vocabulary for computers. Absolutely COOL information!
Computer Vocabulary In Common Use
1. Hardware
2. Software
3. Network Category (Network)
IV. Others
CPU (Center Processor Unit) central processing unit
mainboard motherboard
RAM (random access
memory) random access memory (memory)
ROM (Read Only Memory) read-only memory
Floppy Disk
Hard Disk
CD-ROM drive (optical drive)
monitor
keyboard
mouse
chip chip
CD-R disc burner
HUB hub
Modem= MOdulator-DEModulator, modem
P-P (Plug and Play )Plug and play
UPS (Uninterruptable Power Supply) uninterruptible power supply
BIOS (Basic-input-Output
System) basic input and output system
p>
CMOS (Complementary Metal-Oxide-Semiconductor) complementary metal oxide semiconductor
setup installation
uninstall uninstall
wizzard wizard
OS (Operation Systrem) operating system
OA (Office AutoMation) office automation
exit exit
edit
copy copy
cut
paste
delete
select
find
select all
replace
undo
redo
program
< p>license licenseback previous step
next next step
finish
folder folder
Destination Folder
user
click
double click
right click
settings settings
update update
release release
data data
data base database
DBMS (Data Base Manege
System) database management system
view view
insert insertion
object object
configuration configuration
command command
document document
POST (power-on-self-test) power self-test program
cursor Cursor
attribute attribute
icon icon
service pack
Service patch
Option pack function patch
Demo demonstration
short cut shortcut
exception exception
debug debug
previous
column row
row column
restart restart
text text
p>
font
size
scale
interface
function
access
manual guide
active activation
computer languagecomputer language
menu
GUI (graphical user
interfaces ) graphical user interface
template
page setup page settings
password
code Password
print previewprint preview
zoom in
zoom out
pan roam
cruise roam
full screen
tool bar tool bar
status bar status bar
ruler ruler
table table
paragraph paragraph
symbol symbol
style style
execute execution
graphics graphics
< p>image imageUnix is ??an operating system used for servers
Mac OS operating system developed by Apple
OO (Object-Oriented) object-oriented
virus
file file
open open
colse close
new new
< p>save saveexit
clear clear
default
LAN local area network
WAN wide area network< /p>
Client/Server
ATM (Asynchronous
Transfer Mode) asynchronous transfer mode
Network operations of Windows NT Microsoft Corporation System
Internet
WWW (World Wide Web) World Wide Web
protocol
HTTP Hypertext Transfer Protocol
< p>FTP File Transfer ProtocolBrowser
homepage
Webpage
website
URL is a representation method used to specify the location of information on the Internet's WWW service program
Online
ICQ Online Paging
Firewall
Gateway
HTML Hypertext Markup Language
hypertext
hyperlink hyperlink
IP (Address) Internet Protocol (Address)
SearchEngine search engine
TCP/IP is a set of communication protocols used for networks
Telnet remote login
IE (Internet Exp
lorer) Explorer (Microsoft's web browser)
Navigator (Netscape's browser)
multimedia
ISO International Organization for Standardization
ANSI American National Standards Institute
able able
activefile active file
addwatch add watch point
allfiles All files
allrightsreserved
altdirlst switches directory formats
andfixamuchwiderrangeofdiskproblems and can solve a wider range of disk problems
andotherinFORMation and other information
archivefileattribute archive file attribute
assignto assigned to
autoanswer automatic answer
autodetect automatic detection
autoindent automatic indentation
autosave automatic storage
availableonvolume remaining space on the disk
badcommand command error
badcommandorfilename command or file Wrong name
batchparameters batch parameters
binaryfile binary file
binaryfiles binary file
borlandinternational borland international company
bottommargin is blank at the bottom of the page
bydate by date
byextension by extension
byname by name
bytesfree bytes free
callstack call stack
case-sensitive
causespromptingtoconfirmyouwanttooverwritean requires a confirmation prompt when you want to overwrite one
centralpointsoftwareinc ??central point software company< /p>
changedirectory Change directory
changedrive Change drive
changename Change name
characterset character set
checkingfor Checking< /p>
checksadiskanddisplaysastatusreport Check the disk and display a status report
chgdrivepath Change the disk/path
node node
npasswd A proxy password check for UNIX processor, which filters potential passwords before submitting them to the password file.
OSPF Open Shortest Path First Protocol
OSI Model Open System Interconnection Mode
out-of-band attack Out-of-band attack
packet filter packet filter
password password
path path
payload payload
PBX private switch
PCS personal communication service
peer peer
permission permission
plaintext plaintext
PPTP point-to-point tunneling protocol
< p>port portprority priority
protocol protocol
potential browser potential browser
POP Internet e-mail protocol standard
p>is the abbreviation of Post Office Protocol, which is the Internet email protocol standard. We can send and receive emails through hosts with POP
service capabilities. The flaw with this protocol is that when you receive an email, all
correspondence is cleared from the server and downloaded to your local hard drive. Of course, there are also some client programs that can leave e-mails on the server, or set them so that files exceeding a certain size cannot be downloaded. As emails adopt multimedia
formats, emails will become larger and larger. We hope to be able to flexibly control what files to download and when to download them, which requires the
IMAP protocol. The current version of POP is POP3.
process process
proxy proxy
proxy server proxy server
Proxy service is to proxy Web users to get data back, usually using WWW When software wants to connect to a remote terminal to obtain data
it must send a request signal and then send it back byte by byte. After the proxy is set, the signal requesting data will be sent to the Proxy Server first. When the Proxy Server gets the user's request, it will first look for the same data in the cache
. If there is, the Proxy Server will directly pass the data to the user. If the cache does not
< p>If there is data, the Proxy Server will use the bandwidth available on the network to retrieve the data from the remote site, store it in the cache, and transmit it to the user. Even if the line is blocked, it is still faster than the user's own direct crawling.pseudorandom
phreaking refers to the process of controlling the telephone system
RAS remote access service
Remote control remote control
RPC remote procedure call
remote boot remote boot
route routing
router router
routing routing selection
RIP Routing Information Protocol
routed daemon is a UNIX routing service using RIP
routing table routing table
R.U.P Routing Update Protocol
p>RSA is a public key encryption algorithm. And RSA is perhaps the most popular.
script script
search engine search engine
SSL secure socket layer
secure password
SID security identification Character
sender sender
SLIP Serial Line Internet Protocol
server server
server-based network Server-based network
p>session layer
share, sharing ***share
share-level security ***level security
SMTP simple Mail Transfer Protocol
SNMP Simple Network Management Protocol
Site Site
SCSI Small Computer System Interface
snffer Error Detector
snooping snooping
standalone server independent server
strong cipher strong password
stream cipher stream password
strong password strong password
SQL Structured Query Language
subnet mask subnet mask
subdirectory subdirectory
subnet subnet
< p>swap file exchange fileSACL system access control list
S/Key is a one-time password system for secure connections. In S/Key, passwords are never sent over the network. Therefore it cannot be stolen.
sniffer (sniffer) A program that secretly captures data packets passing through the network. Hackers generally use it to try to steal usernames and passwords.
Spoofing Any process involving impersonating another user or host to gain unauthorized access to a target
Time bomb Waiting for a specific time or event to occur It is a program that is activated and causes machine failure
TCPDUMP is a utility tool for capturing data packets in UNIX. It is often used to obtain detailed network communication records.
Traceroute is a commonly used TCP program on UNIX, used to trace the route between the local machine and the remote host
T0, DS0 56 or 64kbps
T1, DS1 24-channel PCM digital voice, the total rate is 1.544Mbps
T3, DS3 28 T1 channels, the operating rate is 44.736Mbps
thin client thin client
thread thread
throughput throughput
transport layer transmission volume
Transport Protocol transmission protocol
trust trust
tunnel secure encrypted link
vector of attack attack vector
Virtual directory virtual directory
Virtual Machine virtual machine
VRML virtual reality Model language
volume file set
vulnerability vulnerability
weak passwurd weak password
well-known ports common port
workstation workstation
X.25 is a packet switching network protocol
zone transfer zone conversion
authentication authentication and identification
authorization authorization
Back Office A software package from Microsoft Corporation
Back up backup
backup browser backup browser
BDC backup domain Controller
baseline
BIOS basic input/output system
Binding, collection
bit bit, binary bit
p>BOOTP Boot Protocol
BGP Boot Gateway Protocol
Bottleneck Bottleneck
bridge bridge, bridge adapter
browser Browser
browsing
channel channel, path
CSU/DSU channel service unit/digital service unit
Checksum checksum
Cluster cluster, cluster
CGI Common Gateway Interface
CGI (Common Gateway Interface) is a common gateway interface that can produce the same result or the result changes with the user. Program that changes based on input
. It can be written in an interpreted interface language or in a compiled programming language
. CGI specifies the interface protocol standard for Web servers to call other executable programs. The Web server interacts with the Web browser by calling the CGI program. That is, the CGI program accepts the information sent by the Web browser to the Web server, processes it, and sends it to the Web server. The response results are then sent back to the web server and web browser. CGI programs generally complete processing of form data in Web pages, database queries, and integration with traditional application systems. Although CGI programs can be written in any programming language, CGI programs written in C language have the characteristics of fast execution speed and high security.
CGI-based attack (CGI-based attack) uses the vulnerability of the public gateway interface to attack, usually with the help of www website
point
crash The system suddenly fails and needs to be rebooted
CD-ROM read-only disk
Component component
data link data link
datagram datagram
default document default document
digital key system digital key control system
disk mirroring disk mirroring
distributed file system Distributed file system
data-driven attack (data-driven attack) relies on hiding or encapsulating data to carry out attacks that can pass through firewalls undetected
.
DNS spoofing (domain name server electronic spoofing) is a method used by attackers to harm domain name servers, which can be achieved by deceiving the high-speed
cache of DNS or internal attacks (usually Pretending to be a legitimate DNS server for attackers)
DoS (hey, it’s not DOS, this is a denial of service, extremely denial of service). Users maliciously use network information services
server, services will be denied to legitimate users.
eavesdropping eavesdropping
encrypted tunnel encrypted tunnel
enterprise network enterprise network
Ethernet Ethernet
External security External security
environment variable environment variable
fax modem fax modem
file attribute file attribute
file system file system< /p>
file file
FORM format
fragments segmentation
frame relay frame relay
firewall firewall
p>Firework (firewall) is a system or a group of systems that strengthens security between the Internet and Intranetp (intranet). A firewall determines which internal services allow outside access, which outsiders are allowed to access allowed internal services, and which external services can be accessed by
insiders. In order for a firewall to be effective, all information from and to the Internet must pass through the firewall.
The firewall only allows authorized information to pass, but the firewall itself cannot be penetrated.
gated daemon gated process (seems to be an early UNIX routing service)
gateway gateway
global account global account
global group global group
group group
group account group account
group identifier group identifier
HCL hardware compatibility table< /p>
Hash hash table
HPFS high-performance file system
Home directory home directory
home page bamboo leaves
hop station, relay section
host host
hyperlink hypertext link
highjacking hijacks the terminal, which means that the attacker captures the control of another user's session. This
occurs rarely, and when it does, it indicates that the target's security has been compromised.
In fact, NetXRay does a good job at this point.
HTPASSWD is a system that uses passwords to protect sites on WWW (UNIX)
icon icon
impersonation attack masquerading attack
index server Index server
ISA Industry Standard Structure
Inherieted Rights Filter Inherited Rights Filter
ISDN Integrated Services Digital Network
interactive user Interactive user
intermediate system Intermediate system
internal security Internal security
Internet Explorer (IE) IBM's World Wide Web browser
Internet server Internet server
Interpreter interpreter
intranet intranet, corporate intranet
intruder intruder
IMAP a mail protocol
It is the abbreviation of Internet Message Access Protocol. IMAP provides a means to manage emails on a remote server
It is similar to the POP protocol, but has more functions than POP. The functions include: downloading only the header of the email, creating multiple mailboxes and in < /p>
Create a folder on the server to save emails.
Java Virtual Machine Java Virtual Machine
java script A scripting language based on the Java language
Jack in is a colloquial term commonly used by hackers, meaning to destroy server security. Behavior
kernel kernel
keys key
keyspace keyspace
Keystroke Recorder (keystroke recorder) Some terms to steal others Tools for username and password
LAN Server LAN Server
Local security Local security
log log, record
logging login
logging login
p>
logoff exit, logout
logical port logical port
logon registration
logon script login script
LFN long file Name
logic bomb A program or code that can cause a system to lock up or malfunction.
mass browser main browser
MAPI
is the abbreviation of Messaging Application Progrmming Interface. Microsoft and other companies developed MAPI, which allows Windows applications to connect to messaging systems ranging from Microsoft Mail to Novell MHS. However, MAPI
is limited to working at a day-to-day level, that is, mail-aware applications that exchange mail and data over the network.
member server member server
menu menu
message message
multilink multi-link
MIME multimedia Internet mail Extensions
MPR multi-protocol router
multiprocessing
Module module
multihomed host multi-home host
MUD
The full English name of MUD is Multiple User Dimension, Multiple User Dialogue or
Multiple User Dungeon, which is translated as "multi-person world", "multi-person dialogue" or "multi-person" Dungeon",
commonly known as the "mud" game.
named pipes named pipes
NDS NetWare directory service
NetBEUI NetBIOS extended user interface
NetBIOS gateway NetBIOS gateway
< p>NetWare network operating system (sorry, I forgot which company developed it)network network
NetBIOS network basic input/output system
NDIS network driver interface specification
NetDDE network dynamic data exchange
NIC network interface card
network layer network layer
Network Monitor a Network monitoring program
network operating system network operating system
network printer network printer
network security network security
network user network user< /p>
NFS Network File System
I have sorted out the professional vocabulary in network security. Although most of it is nonsense, the original intention is that beginners can better understand these vocabulary.
Incomplete and erroneous places are expected to be supplemented by experts:
Access Control List (ACL) access control list
access token access token
account lockout account lockout< /p>
account policies
accounts account
adapter adapter
adaptive speed leveling adaptive speed level adjustment
Address Resolution Protocol (ARP) Address Resolution Protocol
Administrator account Administrator account
ARPANET ARPANET (the predecessor of the internet)
algorithm algorithm
alias alias
allocation allocation, positioning
alias small application
allocation layer application layer
API application programming Interface
anlpasswd A proxy password checker similar to Passwd+
applications
ATM asynchronous delivery mode
attack attack< /p>
audio policy audit policy
auditing auditing, monitoring
back-end back-end
borde boundary
borde gateway border gateway
breakabie breakable
breach breach, violation
cipher password
ciphertext ciphertext
CAlass A domain Class A domain
CAlass B domain Class B domain
CAlass C domain Class C domain
classless addressing< /p>
cleartext plain text
CSNW Netware customer service
client client, client
client/server client/server
< p>code codeCOM port COM port (communication port)
CIX service provider
computer name computer name
crack Enter
cryptanalysis cryptanalysis
DLC data link control
decryption decryption
database database
dafault route Default route
dafault share Default share
denial of service Denial of service
dictionary attack dictionary attack
directory Directory
directory replication directory replication
domain domain
domain controller domain name controller
domain name domain name
The domain name is actually the name of the computer connected to the Internet. Its role is as important as writing people's names and addresses when sending letters.
The domain name structure is as follows: computer host name. Organization name. Network name. Top-level domain name. Domain names expressed in words are easier to remember than IP addresses expressed in numbers. Networks at all levels that join the Internet name computers within the network in accordance with DNS naming rules, and are responsible for completing the conversion of domain names to IP addresses during communication.
DNS Domain Name Server
DNS (Domain Name System) refers to a directory service system that queries domain names or IP addresses on the Internet.
On receiving a request, it can translate another host's domain name into an IP address, or vice versa. Most domain name systems
maintain a large database that describes the correspondence between domain names and IP addresses, and this database is
updated regularly. The translation request usually comes from another computer on the network, which requires an IP address for routing purposes.
DDE Dynamic Data Exchange
DHCP Dynamic Host Configuration Protocol
encryption encryption
EGP External Gateway Protocol
FDDI Fiber Distributed Data Interface
FAT File Allocation Table
FTP (File Transfer Protocol) File Transfer Protocol
filter filter
firmware firmware
flooding
GSNW NetWare gateway service
GDI (graphical device interface) graphical device interface
GUI graphical user interface< /p>
HTML Hypertext Markup Language
HTTP Hypertext Transfer Protocol
IGP Internal Security
ICMP (Internet Control Message Protocol) Internet Control Messaging Protocol
ICMP is the TCP/IP protocol used to send control and error information about the transmission of IP datagrams. When an IP datagram cannot be delivered
to the destination, it may be because the destination machine has suspended service or information traffic is blocked. The router may use ICMP to notify the sender of the failure message
.
IGMP (Internet Group Management Protocol, Internet Group Management Protocol)
This TCP/IP protocol allows Internet hosts to participate in multicasting - a Computer cluster broadcast
An effective means of information
IIS information server
IP (Internet Protocol) Internet Protocol
IRC online chat
p>
ISP Network Service Provider
IPX Internet Packet Protocol
IPC Inter-Process Communication
IRQ Interrupt Request
IP address IP address
IP address is called network protocol address. It is a 32-bit address assigned to the host. It consists of 4 bytes and is divided into dynamic IP address and static IP address. There are two types of IP addresses. A dynamic IP address refers to a different address obtained for each connection, while a static IP address refers to the same fixed address for each connection. Under normal circumstances, the addresses obtained by dialing by telephone
are dynamic, that is, the addresses obtained each time are different.
IP masquerade IP masquerade
IP spoofing IP spoofing
LAN local area network
LPC local procedure call
NNTP Network News Transfer Protocol
PPP Point-to-Point Protocol
It is called Point to Point Protocol, which is used to adapt to applications that cannot be connected to the network line
A protocol established by users to communicate with each other through telephone line connections.
PDC Primary Domain Controller
Telnet Remote Login
TCP/IP Transmission Control Protocol/Internet Protocol
TCP/IP Communication Protocol It mainly includes standards for network communication details on the Internet, as well as a set of network interconnection protocols and path selection algorithms. TCP is a transmission control protocol, which is equivalent to a packing list to ensure that data will not be lost during transmission. IP is an Internet protocol, which is equivalent to the address and name of the consignor and consignor, ensuring that the data reaches the designated location.
TFTP Normal File Transfer Protocol
TFTP is a simplified FTP protocol used by diskless computers to transfer information. It is very simple, so it can be solidified on the hard disk and supports non-authentication operation. TFTP is a very insecure protocol.
Trojan Horse Trojan Horse
URL Uniform Resource Locator
UDP User Datagram Protocol
VDM Virtual DOS Machine
UUCP is a file transfer protocol based on cats that has been used for a long time. It is sometimes used to transfer over the Internet
Usenet news and e-mail, especially on sites with intermittent Internet connections superior. Very few websites now provide anonymous UUCP to access files
. As a file transfer protocol, only those users who are not connected to the Internet and use cats can use this method.
WWW World Wide Web
WWW (Word Wide Web) is the latest information service on the Internet. It is an interactive browsing and retrieval tool based on hypertext files. Users can use WWW to browse, transfer, and edit files in hypertext format on the Internet.
WAN Wide Area Network
virtual server virtual server
Usenet
User communication network Usenet is the main source of information for network news servers. Usenet is a user communication network established voluntarily by the private sector. It uses the Internet to exchange information but does not completely rely on the Internet for communication. Volunteers who use Usenet
must abide by some agreed network usage rules.
USER name user name
USER account user account
Web page web page
OpenGL open graphics language
ODBC Open Database Connection
PCI Peripheral Connection Interface
chooseoneofthefollowing Choose one from the following
clearall Clear all
clearallbreakpoints Clear all breakpoints Click
clearsanattribute clear attributes
clearscommandhistory clear command history
clearscreen clear screen
closeall close all files
codegeneration code generation
colorpalette color palette
commandline command line
commandprompt command prompt
compressedfile compressed file
configuresaharddiskforusewithmsdos configures the hard disk for use by MS-DOS
conventionalmemory conventional memory
copiesdirectoriesandsubdirectoriesexceptemptyones copies directories and subdirectories, except empty ones
copiesfileswiththearchiveattributeset copies and sets the archive Attribute files
copiesoneormorefilestoanotherlocation Copy or move files to another location
copiesthecontentsofonefloppydisktoanother Copy the contents of one floppy disk to another floppy disk
copydiskette Copy disk< /p>
copymovecompfindrenamedeletevervieweditattribwordpprintlist C copy M move O ratio F search R rename D delete V version E browse A attribute W write P print L list
copyrightc Copyright (c
createdospartitionorlogicaldosdrive Create a DOS partition or logical DOS drive
createextendeddospartition Create an extended DOS partition
create logicaldosdrivesintheextendeddospartition Create a logical DOS drive in the extended DOS partition
createprimarydospartition Create a DOS primary partition
p>
createsadirectory creates a directory
createschangesordeletesthevolumelabelofadisk creates, changes or deletes the volume label of the disk
currentfile current file
currentfixeddiskdrive current hard drive
currentsettings current settings
currenttime current time
cursorposition cursor position
defrag defragmentation
dele delete
deletepartitionorlogicaldosdrive delete partition or logical DOS drive
deletesadirectoryandal
lthesubdirectoriesandfilesinit deletes a directory and all subdirectories and all files in it
deltree deletes the tree
devicedriver device driver
dialogbox dialog bar
< p>directionkeys direction keysdirectly
directorylistargument directory display variable
directoryof directory list
directorystructure directory structure
diskaccess disk access
diskcopy disk copy
diskservicescopycomparefindrenameverifyvieweditmaplocateinitialize Disk service function: C copy O compare F search R change volume name V verify browse E edit M picture L search File N format
diskspace disk space
displayfile display file
displayoptions display options
displaypartitioninFORMation display partition information
< p>displaysfilesinspecifieddirectoryandallsubdirectories Display files in the specified directory and all directoriesdisplaysfileswithspecifiedattributes Display files with specified attributes
displaysorchangesfileattributes Display or change file attributes
displaysorsetsthedate Display or device date
displayssetupscreensinmonochromeinsteadofcolor Displays setup screen information in monochrome instead of color
displaystheamountofusedandfreememoryinyoursystem Displays the amount of used and unused memory in your system
displaysthefullpathandnameofeveryfileonthedisk Displays all files on the disk full path and name
displaysthenameofforchangesthecurrentdirectory displays or changes the current directory
doctor doctor
doesn't
doesntchangetheattributedoesn't change the attribute
dosshell DOS shell
doubleclick
doyouwanttodisplaythelogicaldriveinFORMationyn Do you want to display the logical drive information (y/n)?
driveletter drive name
editmenu edit menu
emsmemory ems memory
endoffile end of file
endofline end of line
enterchoice input selection
entiredisk convert disk
environmentvariable environment variable
esc esc
everyfileandsubdirectory all files and subdirectories
existingdestinationfile already exists Directory file
expandedmemory expands memory
expand
tabs extended tags
explicitly
extendedmemory extended memory
fastest