Current location - Trademark Inquiry Complete Network - Overdue credit card - What are the commonly used English words for computer hardware?
What are the commonly used English words for computer hardware?

Commonly used English terms for computers.

Commonly used English terms and vocabulary for computers. Absolutely COOL information!

Computer Vocabulary In Common Use

1. Hardware

2. Software

3. Network Category (Network)

IV. Others

CPU (Center Processor Unit) central processing unit

mainboard motherboard

RAM (random access

memory) random access memory (memory)

ROM (Read Only Memory) read-only memory

Floppy Disk

Hard Disk

CD-ROM drive (optical drive)

monitor

keyboard

mouse

chip chip

CD-R disc burner

HUB hub

Modem= MOdulator-DEModulator, modem

P-P (Plug and Play )Plug and play

UPS (Uninterruptable Power Supply) uninterruptible power supply

BIOS (Basic-input-Output

System) basic input and output system

p>

CMOS (Complementary Metal-Oxide-Semiconductor) complementary metal oxide semiconductor

setup installation

uninstall uninstall

wizzard wizard

OS (Operation Systrem) operating system

OA (Office AutoMation) office automation

exit exit

edit

copy copy

cut

paste

delete

select

find

select all

replace

undo

redo

program

< p>license license

back previous step

next next step

finish

folder folder

Destination Folder

user

click

double click

right click

settings settings

update update

release release

data data

data base database

DBMS (Data Base Manege

System) database management system

view view

insert insertion

object object

configuration configuration

command command

document document

POST (power-on-self-test) power self-test program

cursor Cursor

attribute attribute

icon icon

service pack

Service patch

Option pack function patch

Demo demonstration

short cut shortcut

exception exception

debug debug

previous

column row

row column

restart restart

text text

p>

font

size

scale

interface

function

access

manual guide

active activation

computer languagecomputer language

menu

GUI (graphical user

interfaces ) graphical user interface

template

page setup page settings

password

code Password

print previewprint preview

zoom in

zoom out

pan roam

cruise roam

full screen

tool bar tool bar

status bar status bar

ruler ruler

table table

paragraph paragraph

symbol symbol

style style

execute execution

graphics graphics

< p>image image

Unix is ??an operating system used for servers

Mac OS operating system developed by Apple

OO (Object-Oriented) object-oriented

virus

file file

open open

colse close

new new

< p>save save

exit

clear clear

default

LAN local area network

WAN wide area network< /p>

Client/Server

ATM (Asynchronous

Transfer Mode) asynchronous transfer mode

Network operations of Windows NT Microsoft Corporation System

Internet

WWW (World Wide Web) World Wide Web

protocol

HTTP Hypertext Transfer Protocol

< p>FTP File Transfer Protocol

Browser

homepage

Webpage

website

URL is a representation method used to specify the location of information on the Internet's WWW service program

Online

Email

ICQ Online Paging

Firewall

Gateway

HTML Hypertext Markup Language

hypertext

hyperlink hyperlink

IP (Address) Internet Protocol (Address)

SearchEngine search engine

TCP/IP is a set of communication protocols used for networks

Telnet remote login

IE (Internet Exp

lorer) Explorer (Microsoft's web browser)

Navigator (Netscape's browser)

multimedia

ISO International Organization for Standardization

ANSI American National Standards Institute

able able

activefile active file

addwatch add watch point

allfiles All files

allrightsreserved

altdirlst switches directory formats

andfixamuchwiderrangeofdiskproblems and can solve a wider range of disk problems

andotherinFORMation and other information

archivefileattribute archive file attribute

assignto assigned to

autoanswer automatic answer

autodetect automatic detection

autoindent automatic indentation

autosave automatic storage

availableonvolume remaining space on the disk

badcommand command error

badcommandorfilename command or file Wrong name

batchparameters batch parameters

binaryfile binary file

binaryfiles binary file

borlandinternational borland international company

bottommargin is blank at the bottom of the page

bydate by date

byextension by extension

byname by name

bytesfree bytes free

callstack call stack

case-sensitive

causespromptingtoconfirmyouwanttooverwritean requires a confirmation prompt when you want to overwrite one

centralpointsoftwareinc ??central point software company< /p>

changedirectory Change directory

changedrive Change drive

changename Change name

characterset character set

checkingfor Checking< /p>

checksadiskanddisplaysastatusreport Check the disk and display a status report

chgdrivepath Change the disk/path

node node

npasswd A proxy password check for UNIX processor, which filters potential passwords before submitting them to the password file.

OSPF Open Shortest Path First Protocol

OSI Model Open System Interconnection Mode

out-of-band attack Out-of-band attack

packet filter packet filter

password password

path path

payload payload

PBX private switch

PCS personal communication service

peer peer

permission permission

plaintext plaintext

PPTP point-to-point tunneling protocol

< p>port port

prority priority

protocol protocol

potential browser potential browser

POP Internet e-mail protocol standard

p>

is the abbreviation of Post Office Protocol, which is the Internet email protocol standard. We can send and receive emails through hosts with POP

service capabilities. The flaw with this protocol is that when you receive an email, all

correspondence is cleared from the server and downloaded to your local hard drive. Of course, there are also some client programs that can leave e-mails on the server, or set them so that files exceeding a certain size cannot be downloaded. As emails adopt multimedia

formats, emails will become larger and larger. We hope to be able to flexibly control what files to download and when to download them, which requires the

IMAP protocol. The current version of POP is POP3.

process process

proxy proxy

proxy server proxy server

Proxy service is to proxy Web users to get data back, usually using WWW When software wants to connect to a remote terminal to obtain data

it must send a request signal and then send it back byte by byte. After the proxy is set, the signal requesting data will be sent to the Proxy Server first. When the Proxy Server gets the user's request, it will first look for the same data in the cache

. If there is, the Proxy Server will directly pass the data to the user. If the cache does not

< p>If there is data, the Proxy Server will use the bandwidth available on the network to retrieve the data from the remote site, store it in the cache, and transmit it to the user. Even if the line is blocked, it is still faster than the user's own direct crawling.

pseudorandom

phreaking refers to the process of controlling the telephone system

RAS remote access service

Remote control remote control

RPC remote procedure call

remote boot remote boot

route routing

router router

routing routing selection

RIP Routing Information Protocol

routed daemon is a UNIX routing service using RIP

routing table routing table

R.U.P Routing Update Protocol

p>

RSA is a public key encryption algorithm. And RSA is perhaps the most popular.

script script

search engine search engine

SSL secure socket layer

secure password

SID security identification Character

sender sender

SLIP Serial Line Internet Protocol

server server

server-based network Server-based network

p>

session layer

share, sharing ***share

share-level security ***level security

SMTP simple Mail Transfer Protocol

SNMP Simple Network Management Protocol

Site Site

SCSI Small Computer System Interface

snffer Error Detector

snooping snooping

standalone server independent server

strong cipher strong password

stream cipher stream password

strong password strong password

SQL Structured Query Language

subnet mask subnet mask

subdirectory subdirectory

subnet subnet

< p>swap file exchange file

SACL system access control list

S/Key is a one-time password system for secure connections. In S/Key, passwords are never sent over the network. Therefore it cannot be stolen.

sniffer (sniffer) A program that secretly captures data packets passing through the network. Hackers generally use it to try to steal usernames and passwords.

Spoofing Any process involving impersonating another user or host to gain unauthorized access to a target

Time bomb Waiting for a specific time or event to occur It is a program that is activated and causes machine failure

TCPDUMP is a utility tool for capturing data packets in UNIX. It is often used to obtain detailed network communication records.

Traceroute is a commonly used TCP program on UNIX, used to trace the route between the local machine and the remote host

T0, DS0 56 or 64kbps

T1, DS1 24-channel PCM digital voice, the total rate is 1.544Mbps

T3, DS3 28 T1 channels, the operating rate is 44.736Mbps

thin client thin client

thread thread

throughput throughput

transport layer transmission volume

Transport Protocol transmission protocol

trust trust

tunnel secure encrypted link

vector of attack attack vector

Virtual directory virtual directory

Virtual Machine virtual machine

VRML virtual reality Model language

volume file set

vulnerability vulnerability

weak passwurd weak password

well-known ports common port

workstation workstation

X.25 is a packet switching network protocol

zone transfer zone conversion

authentication authentication and identification

authorization authorization

Back Office A software package from Microsoft Corporation

Back up backup

backup browser backup browser

BDC backup domain Controller

baseline

BIOS basic input/output system

Binding, collection

bit bit, binary bit

p>

BOOTP Boot Protocol

BGP Boot Gateway Protocol

Bottleneck Bottleneck

bridge bridge, bridge adapter

browser Browser

browsing

channel channel, path

CSU/DSU channel service unit/digital service unit

Checksum checksum

Cluster cluster, cluster

CGI Common Gateway Interface

CGI (Common Gateway Interface) is a common gateway interface that can produce the same result or the result changes with the user. Program that changes based on input

. It can be written in an interpreted interface language or in a compiled programming language

. CGI specifies the interface protocol standard for Web servers to call other executable programs. The Web server interacts with the Web browser by calling the CGI program. That is, the CGI program accepts the information sent by the Web browser to the Web server, processes it, and sends it to the Web server. The response results are then sent back to the web server and web browser. CGI programs generally complete processing of form data in Web pages, database queries, and integration with traditional application systems. Although CGI programs can be written in any programming language, CGI programs written in C language have the characteristics of fast execution speed and high security.

CGI-based attack (CGI-based attack) uses the vulnerability of the public gateway interface to attack, usually with the help of www website

point

crash The system suddenly fails and needs to be rebooted

CD-ROM read-only disk

Component component

data link data link

datagram datagram

default document default document

digital key system digital key control system

disk mirroring disk mirroring

distributed file system Distributed file system

data-driven attack (data-driven attack) relies on hiding or encapsulating data to carry out attacks that can pass through firewalls undetected

.

DNS spoofing (domain name server electronic spoofing) is a method used by attackers to harm domain name servers, which can be achieved by deceiving the high-speed

cache of DNS or internal attacks (usually Pretending to be a legitimate DNS server for attackers)

DoS (hey, it’s not DOS, this is a denial of service, extremely denial of service). Users maliciously use network information services

server, services will be denied to legitimate users.

eavesdropping eavesdropping

encrypted tunnel encrypted tunnel

enterprise network enterprise network

Ethernet Ethernet

External security External security

environment variable environment variable

fax modem fax modem

file attribute file attribute

file system file system< /p>

file file

FORM format

fragments segmentation

frame relay frame relay

firewall firewall

p>

Firework (firewall) is a system or a group of systems that strengthens security between the Internet and Intranetp (intranet). A firewall determines which internal services allow outside access, which outsiders are allowed to access allowed internal services, and which external services can be accessed by

insiders. In order for a firewall to be effective, all information from and to the Internet must pass through the firewall.

The firewall only allows authorized information to pass, but the firewall itself cannot be penetrated.

gated daemon gated process (seems to be an early UNIX routing service)

gateway gateway

global account global account

global group global group

group group

group account group account

group identifier group identifier

HCL hardware compatibility table< /p>

Hash hash table

HPFS high-performance file system

Home directory home directory

home page bamboo leaves

hop station, relay section

host host

hyperlink hypertext link

highjacking hijacks the terminal, which means that the attacker captures the control of another user's session. This

occurs rarely, and when it does, it indicates that the target's security has been compromised.

In fact, NetXRay does a good job at this point.

HTPASSWD is a system that uses passwords to protect sites on WWW (UNIX)

icon icon

impersonation attack masquerading attack

index server Index server

ISA Industry Standard Structure

Inherieted Rights Filter Inherited Rights Filter

ISDN Integrated Services Digital Network

interactive user Interactive user

intermediate system Intermediate system

internal security Internal security

Internet Explorer (IE) IBM's World Wide Web browser

Internet server Internet server

Interpreter interpreter

intranet intranet, corporate intranet

intruder intruder

IMAP a mail protocol

It is the abbreviation of Internet Message Access Protocol. IMAP provides a means to manage emails on a remote server

It is similar to the POP protocol, but has more functions than POP. The functions include: downloading only the header of the email, creating multiple mailboxes and in < /p>

Create a folder on the server to save emails.

Java Virtual Machine Java Virtual Machine

java script A scripting language based on the Java language

Jack in is a colloquial term commonly used by hackers, meaning to destroy server security. Behavior

kernel kernel

keys key

keyspace keyspace

Keystroke Recorder (keystroke recorder) Some terms to steal others Tools for username and password

LAN Server LAN Server

Local security Local security

log log, record

logging login

logging login

p>

logoff exit, logout

logical port logical port

logon registration

logon script login script

LFN long file Name

logic bomb A program or code that can cause a system to lock up or malfunction.

mass browser main browser

MAPI

is the abbreviation of Messaging Application Progrmming Interface. Microsoft and other companies developed MAPI, which allows Windows applications to connect to messaging systems ranging from Microsoft Mail to Novell MHS. However, MAPI

is limited to working at a day-to-day level, that is, mail-aware applications that exchange mail and data over the network.

member server member server

menu menu

message message

multilink multi-link

MIME multimedia Internet mail Extensions

MPR multi-protocol router

multiprocessing

Module module

multihomed host multi-home host

MUD

The full English name of MUD is Multiple User Dimension, Multiple User Dialogue or

Multiple User Dungeon, which is translated as "multi-person world", "multi-person dialogue" or "multi-person" Dungeon",

commonly known as the "mud" game.

named pipes named pipes

NDS NetWare directory service

NetBEUI NetBIOS extended user interface

NetBIOS gateway NetBIOS gateway

< p>NetWare network operating system (sorry, I forgot which company developed it)

network network

NetBIOS network basic input/output system

NDIS network driver interface specification

NetDDE network dynamic data exchange

NIC network interface card

network layer network layer

Network Monitor a Network monitoring program

network operating system network operating system

network printer network printer

network security network security

network user network user< /p>

NFS Network File System

I have sorted out the professional vocabulary in network security. Although most of it is nonsense, the original intention is that beginners can better understand these vocabulary.

Incomplete and erroneous places are expected to be supplemented by experts:

Access Control List (ACL) access control list

access token access token

account lockout account lockout< /p>

account policies

accounts account

adapter adapter

adaptive speed leveling adaptive speed level adjustment

Address Resolution Protocol (ARP) Address Resolution Protocol

Administrator account Administrator account

ARPANET ARPANET (the predecessor of the internet)

algorithm algorithm

alias alias

allocation allocation, positioning

alias small application

allocation layer application layer

API application programming Interface

anlpasswd A proxy password checker similar to Passwd+

applications

ATM asynchronous delivery mode

attack attack< /p>

audio policy audit policy

auditing auditing, monitoring

back-end back-end

borde boundary

borde gateway border gateway

breakabie breakable

breach breach, violation

cipher password

ciphertext ciphertext

CAlass A domain Class A domain

CAlass B domain Class B domain

CAlass C domain Class C domain

classless addressing< /p>

cleartext plain text

CSNW Netware customer service

client client, client

client/server client/server

< p>code code

COM port COM port (communication port)

CIX service provider

computer name computer name

crack Enter

cryptanalysis cryptanalysis

DLC data link control

decryption decryption

database database

dafault route Default route

dafault share Default share

denial of service Denial of service

dictionary attack dictionary attack

directory Directory

directory replication directory replication

domain domain

domain controller domain name controller

domain name domain name

The domain name is actually the name of the computer connected to the Internet. Its role is as important as writing people's names and addresses when sending letters.

The domain name structure is as follows: computer host name. Organization name. Network name. Top-level domain name. Domain names expressed in words are easier to remember than IP addresses expressed in numbers. Networks at all levels that join the Internet name computers within the network in accordance with DNS naming rules, and are responsible for completing the conversion of domain names to IP addresses during communication.

DNS Domain Name Server

DNS (Domain Name System) refers to a directory service system that queries domain names or IP addresses on the Internet.

On receiving a request, it can translate another host's domain name into an IP address, or vice versa. Most domain name systems

maintain a large database that describes the correspondence between domain names and IP addresses, and this database is

updated regularly. The translation request usually comes from another computer on the network, which requires an IP address for routing purposes.

DDE Dynamic Data Exchange

DHCP Dynamic Host Configuration Protocol

encryption encryption

EGP External Gateway Protocol

FDDI Fiber Distributed Data Interface

FAT File Allocation Table

FTP (File Transfer Protocol) File Transfer Protocol

filter filter

firmware firmware

flooding

GSNW NetWare gateway service

GDI (graphical device interface) graphical device interface

GUI graphical user interface< /p>

HTML Hypertext Markup Language

HTTP Hypertext Transfer Protocol

IGP Internal Security

ICMP (Internet Control Message Protocol) Internet Control Messaging Protocol

ICMP is the TCP/IP protocol used to send control and error information about the transmission of IP datagrams. When an IP datagram cannot be delivered

to the destination, it may be because the destination machine has suspended service or information traffic is blocked. The router may use ICMP to notify the sender of the failure message

.

IGMP (Internet Group Management Protocol, Internet Group Management Protocol)

This TCP/IP protocol allows Internet hosts to participate in multicasting - a Computer cluster broadcast

An effective means of information

IIS information server

IP (Internet Protocol) Internet Protocol

IRC online chat

p>

ISP Network Service Provider

IPX Internet Packet Protocol

IPC Inter-Process Communication

IRQ Interrupt Request

IP address IP address

IP address is called network protocol address. It is a 32-bit address assigned to the host. It consists of 4 bytes and is divided into dynamic IP address and static IP address. There are two types of IP addresses. A dynamic IP address refers to a different address obtained for each connection, while a static IP address refers to the same fixed address for each connection. Under normal circumstances, the addresses obtained by dialing by telephone

are dynamic, that is, the addresses obtained each time are different.

IP masquerade IP masquerade

IP spoofing IP spoofing

LAN local area network

LPC local procedure call

NNTP Network News Transfer Protocol

PPP Point-to-Point Protocol

It is called Point to Point Protocol, which is used to adapt to applications that cannot be connected to the network line

A protocol established by users to communicate with each other through telephone line connections.

PDC Primary Domain Controller

Telnet Remote Login

TCP/IP Transmission Control Protocol/Internet Protocol

TCP/IP Communication Protocol It mainly includes standards for network communication details on the Internet, as well as a set of network interconnection protocols and path selection algorithms. TCP is a transmission control protocol, which is equivalent to a packing list to ensure that data will not be lost during transmission. IP is an Internet protocol, which is equivalent to the address and name of the consignor and consignor, ensuring that the data reaches the designated location.

TFTP Normal File Transfer Protocol

TFTP is a simplified FTP protocol used by diskless computers to transfer information. It is very simple, so it can be solidified on the hard disk and supports non-authentication operation. TFTP is a very insecure protocol.

Trojan Horse Trojan Horse

URL Uniform Resource Locator

UDP User Datagram Protocol

VDM Virtual DOS Machine

UUCP is a file transfer protocol based on cats that has been used for a long time. It is sometimes used to transfer over the Internet

Usenet news and e-mail, especially on sites with intermittent Internet connections superior. Very few websites now provide anonymous UUCP to access files

. As a file transfer protocol, only those users who are not connected to the Internet and use cats can use this method.

WWW World Wide Web

WWW (Word Wide Web) is the latest information service on the Internet. It is an interactive browsing and retrieval tool based on hypertext files. Users can use WWW to browse, transfer, and edit files in hypertext format on the Internet.

WAN Wide Area Network

virtual server virtual server

Usenet

User communication network Usenet is the main source of information for network news servers. Usenet is a user communication network established voluntarily by the private sector. It uses the Internet to exchange information but does not completely rely on the Internet for communication. Volunteers who use Usenet

must abide by some agreed network usage rules.

USER name user name

USER account user account

Web page web page

OpenGL open graphics language

ODBC Open Database Connection

PCI Peripheral Connection Interface

chooseoneofthefollowing Choose one from the following

clearall Clear all

clearallbreakpoints Clear all breakpoints Click

clearsanattribute clear attributes

clearscommandhistory clear command history

clearscreen clear screen

closeall close all files

codegeneration code generation

colorpalette color palette

commandline command line

commandprompt command prompt

compressedfile compressed file

configuresaharddiskforusewithmsdos configures the hard disk for use by MS-DOS

conventionalmemory conventional memory

copiesdirectoriesandsubdirectoriesexceptemptyones copies directories and subdirectories, except empty ones

copiesfileswiththearchiveattributeset copies and sets the archive Attribute files

copiesoneormorefilestoanotherlocation Copy or move files to another location

copiesthecontentsofonefloppydisktoanother Copy the contents of one floppy disk to another floppy disk

copydiskette Copy disk< /p>

copymovecompfindrenamedeletevervieweditattribwordpprintlist C copy M move O ratio F search R rename D delete V version E browse A attribute W write P print L list

copyrightc Copyright (c

createdospartitionorlogicaldosdrive Create a DOS partition or logical DOS drive

createextendeddospartition Create an extended DOS partition

create logicaldosdrivesintheextendeddospartition Create a logical DOS drive in the extended DOS partition

createprimarydospartition Create a DOS primary partition

p>

createsadirectory creates a directory

createschangesordeletesthevolumelabelofadisk creates, changes or deletes the volume label of the disk

currentfile current file

currentfixeddiskdrive current hard drive

currentsettings current settings

currenttime current time

cursorposition cursor position

defrag defragmentation

dele delete

deletepartitionorlogicaldosdrive delete partition or logical DOS drive

deletesadirectoryandal

lthesubdirectoriesandfilesinit deletes a directory and all subdirectories and all files in it

deltree deletes the tree

devicedriver device driver

dialogbox dialog bar

< p>directionkeys direction keys

directly

directorylistargument directory display variable

directoryof directory list

directorystructure directory structure

diskaccess disk access

diskcopy disk copy

diskservicescopycomparefindrenameverifyvieweditmaplocateinitialize Disk service function: C copy O compare F search R change volume name V verify browse E edit M picture L search File N format

diskspace disk space

displayfile display file

displayoptions display options

displaypartitioninFORMation display partition information

< p>displaysfilesinspecifieddirectoryandallsubdirectories Display files in the specified directory and all directories

displaysfileswithspecifiedattributes Display files with specified attributes

displaysorchangesfileattributes Display or change file attributes

displaysorsetsthedate Display or device date

displayssetupscreensinmonochromeinsteadofcolor Displays setup screen information in monochrome instead of color

displaystheamountofusedandfreememoryinyoursystem Displays the amount of used and unused memory in your system

displaysthefullpathandnameofeveryfileonthedisk Displays all files on the disk full path and name

displaysthenameofforchangesthecurrentdirectory displays or changes the current directory

doctor doctor

doesn't

doesntchangetheattributedoesn't change the attribute

dosshell DOS shell

doubleclick

doyouwanttodisplaythelogicaldriveinFORMationyn Do you want to display the logical drive information (y/n)?

driveletter drive name

editmenu edit menu

emsmemory ems memory

endoffile end of file

endofline end of line

enterchoice input selection

entiredisk convert disk

environmentvariable environment variable

esc esc

everyfileandsubdirectory all files and subdirectories

existingdestinationfile already exists Directory file

expandedmemory expands memory

expand

tabs extended tags

explicitly

extendedmemory extended memory

fastest